- Startseite
- →
- Fakultäten
- →
- Naturwissenschaftliche Fakultät
- →
- Dokumentanzeige
JavaScript is disabled for your browser. Some features of this site may not work without it.
Originalpublikation
Fan, L.; Warnecke, A.; Weder, J.; Preller, M.; Zeilinger, C.: Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site. In: International journal of molecular sciences 23 (2022), Nr. 13, 7150. DOI: https://doi.org/10.3390/ijms23137150
Version im Repositorium
Zum Zitieren der Version im Repositorium verwenden Sie bitte diesen DOI:
https://doi.org/10.15488/12732
| Zusammenfassung: | |
|
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.
|
|
| Lizenzbestimmungen: | CC BY 4.0 Unported - https://creativecommons.org/licenses/by/4.0/ |
| Publikationstyp: | Article |
| Publikationsstatus: | publishedVersion |
| Erstveröffentlichung: | 2022 |
| Schlagwörter (englisch): | triiodothyronine, Hsp90, protein microarray, thermophoresis, molecular docking |
| Fachliche Zuordnung (DDC): | 570 | Biowissenschaften, Biologie, 540 | Chemie |
Die Publikation erscheint in Sammlung(en):
-
Naturwissenschaftliche Fakultät
Frei zugängliche Publikationen aus der Naturwissenschaftlichen Fakultät